7ody/1/1:D/1:A

Sequences

>7ody-a1-m1-cD (length=92) [Search sequence]

PATVAELQAEIAAWIHPLNPDRRPGGTIAKLLEEIGELIASDPLEVADVLILALDLATLL GVDVTEAIRAKLAINRARSWARADNGAMRHIP

>7ody-a1-m1-cA (length=99) [Search sequence]

PATVAELQAEIAAWIHPLNPDRRPGGTIAKLLEEIGELIASDRDPLEVADVLILALDLAT LLGVDVTEAIRAKLAINRARSWARADNGAMRHIPGSDTP

Structure information

PDB ID	7ody (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cyanophage S-2L MazG-like pyrophosphohydrolase bound to dGDP and three catalytic Mn2+ ions per active site
Assembly ID	1
Resolution	1.43Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	20
Sequence identity between the two chains	1.0
PubMed citation	34354070

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	A0A7U3TBV3	A0A7U3TBV3
Species	260586 (Cyanophage S-2L)	260586 (Cyanophage S-2L)
Function annotation	BioLiP:7odyD	BioLiP:7odyA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7ody-a1-m1-cD_7ody-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7ody-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

7ody/1/1:D/1:C 7ody/1/1:B/1:A