7og8/1/2:A/6:A

Sequences

>7og8-a1-m2-cA (length=68) [Search sequence]

GQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTSVTQMVYKHAISTI VPARSVNL

>7og8-a1-m6-cA (length=68) [Search sequence]

GQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTSVTQMVYKHAISTI VPARSVNL

Structure information

PDB ID	7og8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Wild-type Hfq protein from Neisseria meningitidis
Assembly ID	1
Resolution	1.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	64
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	6
Chain ID	A	A
UniProt accession	A1KT11	A1KT11
Species	272831 (Neisseria meningitidis FAM18)	272831 (Neisseria meningitidis FAM18)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7og8-a1-m2-cA_7og8-a1-m6-cA.pdb.gz

Full biological assembly Download: 7og8-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3sb2/1/1:B/1:A 3sb2/1/1:C/1:B 3sb2/1/1:C/1:D 3sb2/1/1:D/1:E 3sb2/1/1:E/1:F 3sb2/1/1:F/1:A 7og8/1/1:A/5:A 7og8/1/1:A/6:A 7og8/1/2:A/4:A 7og8/1/3:A/4:A 7og8/1/3:A/5:A 7ogw/1/1:A/5:A 7ogw/1/1:A/6:A 7ogw/1/2:A/4:A 7ogw/1/2:A/6:A 7ogw/1/3:A/4:A 7ogw/1/3:A/5:A 7oh8/1/1:A/1:B 7oh8/1/1:A/2:C 7oh8/1/1:B/1:C 7oh8/1/2:A/1:C 7oh8/1/2:A/2:B 7oh8/1/2:B/2:C