7p42/1/1:A/1:B

Sequences
>7p42-a1-m1-cA (length=136) [Search sequence]
IDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMG
LAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSN
DEKLKIKAQSYLDAIQ
>7p42-a1-m1-cB (length=142) [Search sequence]
GSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFY
NVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFE
LVIQHSNDEKLKIKAQSYLDAI
Structure information
PDB ID 7p42 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of IpgC in complex with a follow-up compound based on J2
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 65
Sequence identity between the two chains 0.993
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P0A2U4 P0A2U4
Species 623 (Shigella flexneri) 623 (Shigella flexneri)
Function annotation BioLiP:7p42B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7p42-a1-m1-cA_7p42-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7p42-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6scb/1/1:A/1:B 7ayw/1/1:A/1:B 7azv/1/1:B/1:A 7b1u/1/1:A/1:B 7nhw/1/1:A/1:B 7o04/1/1:B/1:A 7o6s/1/1:A/1:B 7pe0/1/1:A/1:B 7pef/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 3gyz/1/1:A/1:B 3gz1/1/1:B/1:A 3gz2/1/1:B/1:A
  • 3ks2/2/1:C/1:D 3ks2/1/1:A/1:B 3ks2/3/1:E/1:F 3ks2/4/1:G/1:H 3ks2/5/1:I/1:J 3ks2/6/1:K/1:L 3ks2/7/1:M/1:N 3ks2/8/1:O/1:P 3ks2/9/1:Q/1:R
    		•

    [Back to Home]