7p4v/1/2:A/3:A

Sequences
>7p4v-a1-m2-cA (length=113) [Search sequence]
HMKKVEAIIRPERLDIVKNALSDAGYVGMTVSEVKGRGIQGGIVERYRGREYIVDLLPKI
KIEMAVNDEDVEKVIDIICENAKTGEFGDGKIFVIPIEEVVRVRTGERGNDAI
>7p4v-a1-m3-cA (length=113) [Search sequence]
HMKKVEAIIRPERLDIVKNALSDAGYVGMTVSEVKGRGIQGGIVERYRGREYIVDLLPKI
KIEMAVNDEDVEKVIDIICENAKTGEFGDGKIFVIPIEEVVRVRTGERGNDAI
Structure information
PDB ID 7p4v (database links: RCSB PDB PDBe PDBj PDBsum)
Title GlnK1 from Methanothermococcus thermolithotrophicus with dADP at a resolution of 1.94 A
Assembly ID 1
Resolution 1.94Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 81
Sequence identity between the two chains 1.0
PubMed citation 34445335
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession
Species 523845 (Methanothermococcus thermolithotrophicus DSM 2095) 523845 (Methanothermococcus thermolithotrophicus DSM 2095)
Function annotation BioLiP:7p4vA BioLiP:7p4vA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7p4v-a1-m2-cA_7p4v-a1-m3-cA.pdb.gz
Full biological assembly
Download: 7p4v-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7p4v/1/1:A/2:A 7p4v/1/1:A/3:A

[Back to Home]