7p50/1/1:B/1:C

Sequences
>7p50-a1-m1-cB (length=115) [Search sequence]
GSHMKKVEAIIRPERLDIVKNSLTDAGYVGMTVSEVKGRGIQGGIVERYRGREYTVDLLP
KIKIELVVKEEDVEKIIDIICENAKTGNQGDGKVFIIPVEEVVRVRTKERGRGAI
>7p50-a1-m1-cC (length=115) [Search sequence]
GSHMKKVEAIIRPERLDIVKNSLTDAGYVGMTVSEVKGRGIQGGIVERYRGREYTVDLLP
KIKIELVVKEEDVEKIIDIICENAKTGNQGDGKVFIIPVEEVVRVRTKERGRGAI
Structure information
PDB ID 7p50 (database links: RCSB PDB PDBe PDBj PDBsum)
Title GlnK2 from Methanothermococcus thermolithotrophicus in complex with Mg-ATP and 2-oxoglutarate at a resolution of 1.16 A
Assembly ID 1
Resolution 1.16Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 83
Sequence identity between the two chains 1.0
PubMed citation 34445335
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession
Species 523845 (Methanothermococcus thermolithotrophicus DSM 2095) 523845 (Methanothermococcus thermolithotrophicus DSM 2095)
Function annotation BioLiP:7p50B BioLiP:7p50C
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7p50-a1-m1-cB_7p50-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7p50-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7p50/1/1:B/1:A 7p50/1/1:C/1:A

[Back to Home]