7p50/1/1:B/1:C

Sequences

>7p50-a1-m1-cB (length=115) [Search sequence]

GSHMKKVEAIIRPERLDIVKNSLTDAGYVGMTVSEVKGRGIQGGIVERYRGREYTVDLLP KIKIELVVKEEDVEKIIDIICENAKTGNQGDGKVFIIPVEEVVRVRTKERGRGAI

>7p50-a1-m1-cC (length=115) [Search sequence]

GSHMKKVEAIIRPERLDIVKNSLTDAGYVGMTVSEVKGRGIQGGIVERYRGREYTVDLLP KIKIELVVKEEDVEKIIDIICENAKTGNQGDGKVFIIPVEEVVRVRTKERGRGAI

Structure information

PDB ID	7p50 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	GlnK2 from Methanothermococcus thermolithotrophicus in complex with Mg-ATP and 2-oxoglutarate at a resolution of 1.16 A
Assembly ID	1
Resolution	1.16Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	83
Sequence identity between the two chains	1.0
PubMed citation	34445335

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession
Species	523845 (Methanothermococcus thermolithotrophicus DSM 2095)	523845 (Methanothermococcus thermolithotrophicus DSM 2095)
Function annotation	BioLiP:7p50B	BioLiP:7p50C

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7p50-a1-m1-cB_7p50-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7p50-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7p50/1/1:B/1:A 7p50/1/1:C/1:A