7pbw/1/1:AH/1:AI

Sequences
>7pbw-a1-m1-cAH (length=49) [Search sequence]
TNGKIWLVVKPTVGVPLFLSAAVIASVVIHAAVLTTTTWLPAYYQGSAA
>7pbw-a1-m1-cAI (length=49) [Search sequence]
TNGKIWLVVKPTVGVPLFLSAAVIASVVIHAAVLTTTTWLPAYYQGSAA
Structure information
PDB ID 7pbw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cryo-EM structure of light harvesting complex 2 from Rba. sphaeroides.
Assembly ID 1
Resolution 2.1Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
PubMed citation 34699186
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID AH AI
UniProt accession Q3J144 Q3J144
Species 272943 (Cereibacter sphaeroides 2.4.1) 272943 (Cereibacter sphaeroides 2.4.1)
Function annotation BioLiP:7pbwAH BioLiP:7pbwAI
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7pbw-a1-m1-cAH_7pbw-a1-m1-cAI.pdb.gz
Full biological assembly
Download: 7pbw-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7pbw/1/1:AA/1:AB 7pbw/1/1:AA/1:AI 7pbw/1/1:AB/1:AC 7pbw/1/1:AC/1:AD 7pbw/1/1:AD/1:AE 7pbw/1/1:AE/1:AF 7pbw/1/1:AF/1:AG 7pbw/1/1:AG/1:AH

[Back to Home]