7pok/1/1:D/1:A

Sequences

>7pok-a1-m1-cD (length=90) [Search sequence]

KRVCRFCLTEQKLASIFEETTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRF KQMCKRAETLLRQYPLTGNWPSPLEKPRAP

>7pok-a1-m1-cA (length=98) [Search sequence]

KRVCRFCLTEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFE HCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPISS

Structure information

PDB ID	7pok (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of ZAD-domain of Pita protein from D.melanogaster
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	93
Sequence identity between the two chains	1.0
PubMed citation	35580610

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	Q95RQ8	Q95RQ8
Species	7227 (Drosophila melanogaster)	7227 (Drosophila melanogaster)
Function annotation	BioLiP:7pokD	BioLiP:7pokA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7pok-a1-m1-cD_7pok-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7pok-assembly1.cif.gz