7pok/1/1:D/1:B

Sequences
>7pok-a1-m1-cD (length=90) [Search sequence]
KRVCRFCLTEQKLASIFEETTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRF
KQMCKRAETLLRQYPLTGNWPSPLEKPRAP
>7pok-a1-m1-cB (length=93) [Search sequence]
MLTEKRVCRFCLTEQKLASIFEETANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHC
YRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAP
Structure information
PDB ID 7pok (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of ZAD-domain of Pita protein from D.melanogaster
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 0.989
PubMed citation 35580610
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D B
UniProt accession Q95RQ8 Q95RQ8
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
Function annotation BioLiP:7pokD BioLiP:7pokB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7pok-a1-m1-cD_7pok-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7pok-assembly1.cif.gz
Similar dimers

[Back to Home]