7ppp/1/1:B/1:A

Sequences
>7ppp-a1-m1-cB (length=61) [Search sequence]
HCRLCHGKFSVFVRDFQRLLGVAVHQDPALSQFVCRNCHAQFYQCHSLLESFLQRVNVSP
M
>7ppp-a1-m1-cA (length=73) [Search sequence]
HCRLCHGKFSSRSLRSISDGERVFVRDFQRLLGVAVHQDPALSQFVCRNCHAQFYQCHSL
LESFLQRVNVSPM
Structure information
PDB ID 7ppp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of ZAD-domain of ZNF_276 protein from rabbit.
Assembly ID 1
Resolution 2.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 73
Sequence identity between the two chains 1.0
PubMed citation 35580610
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession A0A5F9DAT3 A0A5F9DAT3
Species 9986 (Oryctolagus cuniculus) 9986 (Oryctolagus cuniculus)
Function annotation BioLiP:7pppB BioLiP:7pppA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7ppp-a1-m1-cB_7ppp-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7ppp-assembly1.cif.gz

[Back to Home]