7pvz/1/1:A/1:B

Sequences
>7pvz-a1-m1-cA (length=60) [Search sequence]
GGVTTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
>7pvz-a1-m1-cB (length=60) [Search sequence]
GGVTTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Structure information
PDB ID 7pvz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the intertwined dimer of the c-Src SH3 domain E93V-S94A-R95S-T96G mutant
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 154
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P00523 P00523
Species 9031 (Gallus gallus) 9031 (Gallus gallus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7pvz-a1-m1-cA_7pvz-a1-m1-cB.pdb.gz
Full biological assembly
Download: 7pvz-assembly1.cif.gz

[Back to Home]