7qcr/1/1:B/1:A

Sequences
>7qcr-a1-m1-cB (length=86) [Search sequence]
EIITVTLKKQNGMGLSIVAAKDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGL
SQERAAELMTRTSSVVTLEVAKQGAI
>7qcr-a1-m1-cA (length=87) [Search sequence]
PEIITVTLKKQNGMGLSIVAAKDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVG
LSQERAAELMTRTSSVVTLEVAKQGAI
Structure information
PDB ID 7qcr (database links: RCSB PDB PDBe PDBj PDBsum)
Title MLLT4/Afadin PDZ domain in complex with the C-terminal peptide from protein E of SARS-CoV-2
Assembly ID 1
Resolution 2.28Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 108
Sequence identity between the two chains 1.0
PubMed citation 35283834
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P55196 P55196
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7qcrB BioLiP:7qcrA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7qcr-a1-m1-cB_7qcr-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7qcr-assembly1.cif.gz

[Back to Home]