7qcs/1/1:A/1:B

Sequences

>7qcs-a1-m1-cA (length=97) [Search sequence]

DERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEG DEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPS

>7qcs-a1-m1-cB (length=98) [Search sequence]

TDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHE GDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPS

Structure information

PDB ID	7qcs (database links: RCSB PDB PDBe PDBj PDBsum)
Title	PALS1/MPP5 PDZ domain in complex with SARS-CoV-2_E PBM peptide
Assembly ID	1
Resolution	2.804Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	36
Sequence identity between the two chains	1.0
PubMed citation	35283834

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q8N3R9	Q8N3R9
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7qcsA	BioLiP:7qcsB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7qcs-a1-m1-cA_7qcs-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7qcs-assembly1.cif.gz