7qrt/1/1:B/1:A

Sequences
>7qrt-a1-m1-cB (length=91) [Search sequence]
SRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGAAHRAGTLQVGDRVLSI
NGVDVTEARHDHAVSLLTAASPTIALLLERE
>7qrt-a1-m1-cA (length=92) [Search sequence]
SRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGAAHRAGTLQVGDRVLSI
NGVDVTEARHDHAVSLLTAASPTIALLLEREA
Structure information
PDB ID 7qrt (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural insight into the Scribble PDZ domains interaction with the oncogenic Human T-cell lymphotrophic virus-1 (HTLV-1) Tax1
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
PubMed citation 36029163
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q14160 Q14160
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7qrtB BioLiP:7qrtA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7qrt-a1-m1-cB_7qrt-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7qrt-assembly1.cif.gz

[Back to Home]