7r1l/1/1:A/1:C

Sequences
>7r1l-a1-m1-cA (length=46) [Search sequence]
MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIP
>7r1l-a1-m1-cC (length=47) [Search sequence]
MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIPN
Structure information
PDB ID 7r1l (database links: RCSB PDB PDBe PDBj PDBsum)
Title Clostridium thermocellum CtCBM50 structure in complex with beta-1,4-GlcNAc trisaccharide
Assembly ID 1
Resolution 1.45Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession A3DC59 A3DC59
Species 1515 (Acetivibrio thermocellus) 1515 (Acetivibrio thermocellus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7r1l-a1-m1-cA_7r1l-a1-m1-cC.pdb.gz
Full biological assembly
Download: 7r1l-assembly1.cif.gz

[Back to Home]