7r31/1/1:A/1:B

Sequences
>7r31-a1-m1-cA (length=99) [Search sequence]
KPANKLVIVTEKILLKKIAKIIDESGAKGYTVMNTGGKGSRNVRSSGQPNTSDIEANIKF
EILTETREMAEEIADRVAVKYFNDYAGIIYICSAEVLYG
>7r31-a1-m1-cB (length=100) [Search sequence]
KPANKLVIVTEKILLKKIAKIIDESGAKGYTVMNTGGKGSRNVRSSGQPNTSDIEANIKF
EILTETREMAEEIADRVAVKYFNDYAGIIYICSAEVLYGH
Structure information
PDB ID 7r31 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Carbon regulatory PII-like protein SbtB from Synechocystis sp. 6803, C105A+C110A variant, in complex with ATP (co-crystal), tetragonal crystal form
Assembly ID 1
Resolution 1.52Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
PubMed citation 36800386
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P73954 P73954
Species 1148 (Synechocystis sp. PCC 6803) 1148 (Synechocystis sp. PCC 6803)
Function annotation BioLiP:7r31A BioLiP:7r31B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7r31-a1-m1-cA_7r31-a1-m1-cB.pdb.gz
Full biological assembly
Download: 7r31-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7cyf/1/1:D/1:E 7cyf/1/1:D/1:F 7cyf/1/1:E/1:F 7egk/1/1:B/1:D 7egk/1/1:B/1:F 7egk/1/1:D/1:F 7r32/1/1:C/1:B

[Back to Home]