7r3g/1/1:A/1:B

Sequences

>7r3g-a1-m1-cA (length=236) [Search sequence]

GFLDWWEDLRSEMQSITDSQEVFAVLEKEVRRLGFDYYAYCVRHPIPFTRPRIFMFGNYP
PAWQEHYQAQNYFAIDPTIRHCLRSGNHIVWSDDLFADAQELWDDARDYGLRHGATHSCM
APNGVMGFLSVARSSPAISPHEREELRLRMRCLIELLHQTLTELNHPSLQPQPICLSKRE
REILRWTADGKTSAEIAKILGISESTVNFHLKNIQKKFNAPNKTQAAAYAAALGLI

>7r3g-a1-m1-cB (length=236) [Search sequence]

Structure information

PDB ID	7r3g (database links: RCSB PDB PDBe PDBj PDBsum)
Title	PROSS optimitzed variant of RhlR (75 mutations) in complex with the synthetic antagonist mBTL
Assembly ID	1
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	129
Sequence identity between the two chains	1.0
PubMed citation	36456567

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P54292	P54292
Species	208964 (Pseudomonas aeruginosa PAO1)	208964 (Pseudomonas aeruginosa PAO1)
Function annotation	BioLiP:7r3gA	BioLiP:7r3gB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7r3g-a1-m1-cA_7r3g-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7r3g-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7r3h/1/1:A/1:B 7r3h/2/1:C/1:D 7r3i/1/1:A/1:B