7re5/1/1:E/1:A

Sequences

>7re5-a1-m1-cE (length=107) [Search sequence]

HMCSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFD RHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCC

>7re5-a1-m1-cA (length=108) [Search sequence]

SHMCSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFF DRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCC

Structure information

PDB ID	7re5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of The Tetramerization Domain (29-147) From Human Voltage-gated Potassium Channel Kv2.1 in P 41 21 2 Space Group
Assembly ID	1
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	51
Sequence identity between the two chains	1.0
PubMed citation	35647925

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	A
UniProt accession	Q14721	Q14721
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7re5E	BioLiP:7re5A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7re5-a1-m1-cE_7re5-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7re5-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7re5/1/1:A/1:B 7re5/1/1:C/1:B 7re5/1/1:C/1:D 7re5/1/1:E/1:D 7spd/1/1:B/1:A 7spd/1/1:B/1:C 7spd/1/1:C/1:D 7spd/1/1:E/1:A 7spd/1/1:E/1:D