7rga/1/1:B/1:G

Sequences

>7rga-a1-m1-cB (length=265) [Search sequence]

NPSLIRSESWHVYDGNEANLLDGDDNTGVWYKRSNGEASLAGEFIGLDLGKEIKLDGIRF
VIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRL
TNLEPRHVQLTFSEFAIVSDSQVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQ
APGKEREFVAKISGDGRLTTYGDSVKGRFTISRDNAEYLVYLQMDSLKPEDTAVYYCAAD
DNYVTASWRSGPDYWGQGTQVTVSS

>7rga-a1-m1-cG (length=265) [Search sequence]

Structure information

PDB ID	7rga (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of nanoCLAMP3:VHH in complex with MTX
Assembly ID	1
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	21
Sequence identity between the two chains	1.0
PubMed citation	34880210

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	G
UniProt accession	P26831	P26831
Species	32630 (synthetic construct)	32630 (synthetic construct)
Function annotation	BioLiP:7rgaB	BioLiP:7rgaG

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7rga-a1-m1-cB_7rga-a1-m1-cG.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7rga-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7rga/1/1:A/1:D 7rga/1/1:A/1:E
Other dimers with similar sequences but different poses	3qxu/4/1:B/1:D 3qxu/2/1:B/1:D 7rga/1/1:G/1:E 7rga/1/1:A/1:B