7rye/1/1:F/1:R

Sequences

>7rye-a1-m1-cF (length=212) [Search sequence]

ISDAEIWDMVSQNISAIGDSYLGVYENVVAVYTDFYQAFSDILSKMGGWLLPGKDGNTVK
LDVTSLKNDLNSLVNKYNQINSNTVLFPAQSGSGVKVATEAEARQWLSELNLPNSCLKSY
GSGYVVTVDLTPLQKMVQDIDGLGAPGKDSKLEMDNAKYQAWQSGFKAQEENMKTTLQTL
TQKYSNANSLYDNLVKVLSSTISSSLETAKSF

>7rye-a1-m1-cR (length=212) [Search sequence]

Structure information

PDB ID	7rye (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structure of the needle filament-tip complex of the Salmonella type III secretion injectisome
Assembly ID	1
Resolution	3.9Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	11
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	R
UniProt accession	Q56026	Q56026
Species	90371 (Salmonella enterica subsp. enterica serovar Typhimurium)	90371 (Salmonella enterica subsp. enterica serovar Typhimurium)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7rye-a1-m1-cF_7rye-a1-m1-cR.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7rye-assembly1.cif.gz