7s03/1/1:A/2:A

Sequences
>7s03-a1-m1-cA (length=103) [Search sequence]
KLDKKQIRAIFLFEFKGRKAAETTRNNNAFGPGTANERTVQWWFKKFRKGDESLEDEERS
GRPSEVDNDQLRAIIEADPLTTTREVAEENVNHSTVVRHLKQI
>7s03-a1-m2-cA (length=103) [Search sequence]
KLDKKQIRAIFLFEFKGRKAAETTRNNNAFGPGTANERTVQWWFKKFRKGDESLEDEERS
GRPSEVDNDQLRAIIEADPLTTTREVAEENVNHSTVVRHLKQI
Structure information
PDB ID 7s03 (database links: RCSB PDB PDBe PDBj PDBsum)
Title DNA-binding domain of human SETMAR in complex with Hsmar1 terminal inverted repeat (TIR) DNA
Assembly ID 1
Resolution 2.37Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
PubMed citation 35378129
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q53H47 Q53H47
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7s03A BioLiP:7s03A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7s03-a1-m1-cA_7s03-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7s03-assembly1.cif.gz

[Back to Home]