7s94/2/1:E/1:F

Sequences

>7s94-a2-m1-cE (length=76) [Search sequence]

LHRIVTEDLQALEKSVSNLEESLTSLSEVVLQNRRGLDLLFLKEGGLCVALKEECSFYVD HSGAIRDSMSKLRERL

>7s94-a2-m1-cF (length=83) [Search sequence]

KGLSNLHRIVTEDLQALEKSVSNLEESLTSLSEVVLQNRRGLDLLFLKEGGLCVALKEEC SFYVDHSGAIRDSMSKLRERLEK

Structure information

PDB ID	7s94 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the core postfusion porcine endogenous retrovirus fusion protein
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	92
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	B3VQ66	B3VQ66
Species	9823 (Sus scrofa)	9823 (Sus scrofa)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7s94-a2-m1-cE_7s94-a2-m1-cF.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7s94-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7s94/1/1:A/1:C 7s94/1/1:B/1:A 7s94/1/1:B/1:C 7s94/2/1:E/1:D 7s94/2/1:F/1:D