7sat/1/1:F/1:E

Sequences

>7sat-a1-m1-cF (length=77) [Search sequence]

GHYRRYKNILEMYLASHKGRRLLNIVYSWGAAVVILGALFKLLHLPMGNEMLFVGMITEF LVFFISGFEKPAMEYHW

>7sat-a1-m1-cE (length=80) [Search sequence]

GHYRRYKNILEMYLASHKGRRLLNIVYSWGAAVVILGALFKLLHLPMGNEMLFVGMITEF LVFFISGFEKPAMEYHWEEV

Structure information

PDB ID	7sat (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of PorLM, the proton-powered motor that drives Type IX protein secretion
Assembly ID	1
Resolution	3.9Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	38
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	E
UniProt accession	B2RLE9	B2RLE9
Species	431947 (Porphyromonas gingivalis ATCC 33277)	431947 (Porphyromonas gingivalis ATCC 33277)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7sat-a1-m1-cF_7sat-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7sat-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7sat/1/1:C/1:G 7sat/1/1:D/1:C 7sat/1/1:D/1:E 7sat/1/1:F/1:G