7sax/1/1:G/1:C

Sequences
>7sax-a1-m1-cG (length=50) [Search sequence]
FGINTLINWGATVVIIGLMFKILHLKGGEWMIGVGLAVEALLFFIMGFMQ
>7sax-a1-m1-cC (length=60) [Search sequence]
FGINTLINWGATVVIIGLMFKILHLKGGEWMIGVGLAVEALLFFIMGFMQAEQEPDWTRV
Structure information
PDB ID 7sax (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of GldLM, the proton-powered motor that drives Type IX protein secretion and gliding motility in Sphingobacterium wenxiniae
Assembly ID 1
Resolution 3.0Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G C
UniProt accession A0A1I6R6J4 A0A1I6R6J4
Species 683125 (Sphingobacterium wenxiniae) 683125 (Sphingobacterium wenxiniae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7sax-a1-m1-cG_7sax-a1-m1-cC.pdb.gz
Full biological assembly
Download: 7sax-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7sax/1/1:E/1:D 7sax/1/1:E/1:F 7sax/1/1:F/1:G

[Back to Home]