7say/2/1:C/1:D

Sequences
>7say-a2-m1-cC (length=53) [Search sequence]
QLEDKVEELLSKNYHLENEVARLKKLVSKLEKQLEEAQKDYSEIEGKLEQFWH
>7say-a2-m1-cD (length=67) [Search sequence]
SMKQLEDKVEELLSKNYHLENEVARLKKLVSKLEKQLEEAQKDYSEIEGKLEQFWHDYDK
LEKENKE
Structure information
PDB ID 7say (database links: RCSB PDB PDBe PDBj PDBsum)
Title Fragment of streptococcal M87 protein fused to GCN4 adaptor in complex with human cathelicidin
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 60
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q6TLP8 Q6TLP8
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7say-a2-m1-cC_7say-a2-m1-cD.pdb.gz
Full biological assembly
Download: 7say-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7saf/1/1:A/1:B 7say/1/1:A/1:B

[Back to Home]