7saz/1/1:E/1:F

Sequences
>7saz-a1-m1-cE (length=56) [Search sequence]
KIFQMAYGIGASIVILGALFKILHWEIDFGGFKLGGGFLLAFGLITEAIIFFISAF
>7saz-a1-m1-cF (length=57) [Search sequence]
KIFQMAYGIGASIVILGALFKILHWEIDFGGFKLGGGFLLAFGLITEAIIFFISAFE
Structure information
PDB ID 7saz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of GldLM, the proton-powered motor that drives Type IX protein secretion and gliding motility in Capnocytophaga canimorsus
Assembly ID 1
Resolution 3.0Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 39
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession F9YQB6 F9YQB6
Species 860228 (Capnocytophaga canimorsus Cc5) 860228 (Capnocytophaga canimorsus Cc5)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7saz-a1-m1-cE_7saz-a1-m1-cF.pdb.gz
Full biological assembly
Download: 7saz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7saz/1/1:D/1:C 7saz/1/1:E/1:D 7saz/1/1:F/1:G 7saz/1/1:G/1:C

[Back to Home]