7sbj/1/1:B/1:C

Sequences

>7sbj-a1-m1-cB (length=221) [Search sequence]

CLIAPSILSANFARLGEEVDNVLAAGADWVHFDVMDNHYVPNLTIGPMVCQALRKHGVTA
PIDVHLMVEPVDRIIPDFAEAGATYISFHPEASRHVHRTIQLIRSLGCKPGIVLNPATPV
DILDWVLDDLDLVLLMSVNPGFGGQAFIPSALDKLKVVRKMIDASGKDIRLEIDGGVKAD
NIGEIAAAGADTFVAGSAIFNAKTSYQDVIAQMRANVAAAR

>7sbj-a1-m1-cC (length=221) [Search sequence]

Structure information

PDB ID	7sbj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Ribulose-phosphate 3-epimerase from Stenotrophomonas maltophilia K279a
Assembly ID	1
Resolution	1.85Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	86
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	B2FKL8	B2FKL8
Species	522373 (Stenotrophomonas maltophilia K279a)	522373 (Stenotrophomonas maltophilia K279a)
Function annotation	BioLiP:7sbjB	BioLiP:7sbjC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7sbj-a1-m1-cB_7sbj-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7sbj-assembly1.cif.gz