7sfy/2/1:D/1:E

Sequences
>7sfy-a2-m1-cD (length=29) [Search sequence]
VEIEKSLTQMEDVLKALQMKLWEAESKLS
>7sfy-a2-m1-cE (length=31) [Search sequence]
SRVEIEKSLTQMEDVLKALQMKLWEAESKLS
Structure information
PDB ID 7sfy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human Mis18ab_cc
Assembly ID 2
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession Q9NYP9 Q9NYP9
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7sfyE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7sfy-a2-m1-cD_7sfy-a2-m1-cE.pdb.gz
Full biological assembly
Download: 7sfy-assembly2.cif.gz
Similar dimers

[Back to Home]