7ska/1/1:O/1:Z

Sequences
>7ska-a1-m1-cO (length=142) [Search sequence]
GFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIRQLQARV
LAVERYLRDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNNMTWMEWDREINNYTS
LIHSLIEEAQNQQEKNEQELLE
>7ska-a1-m1-cZ (length=142) [Search sequence]
GFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIRQLQARV
LAVERYLRDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNNMTWMEWDREINNYTS
LIHSLIEEAQNQQEKNEQELLE
Structure information
PDB ID 7ska (database links: RCSB PDB PDBe PDBj PDBsum)
Title Sub-tomogram averaged structure of HIV-1 Envelope protein in native membrane
Assembly ID 1
Resolution 9.1Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
PubMed citation 35123651
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID O Z
UniProt accession Q6TAN8 Q6TAN8
Species 11676 (Human immunodeficiency virus 1) 11676 (Human immunodeficiency virus 1)
Function annotation BioLiP:7skaO BioLiP:7skaZ
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7ska-a1-m1-cO_7ska-a1-m1-cZ.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7ska-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7ska/1/1:B/1:O 7ska/1/1:B/1:Z
Other dimers with similar sequences but different poses
  • 7n6w/1/1:C/1:A 6nij/1/1:D/1:B 7n6u/1/1:A/1:B 7n6u/1/1:C/1:A 7n6w/1/1:A/1:B
  • [Back to Home]