7sq4/1/2:A/3:A

Sequences
>7sq4-a1-m2-cA (length=48) [Search sequence]
DEQRRELEEKIKWKLAELASKSEEERKEIKLRVIAYVLVQLEDLQKNL
>7sq4-a1-m3-cA (length=48) [Search sequence]
DEQRRELEEKIKWKLAELASKSEEERKEIKLRVIAYVLVQLEDLQKNL
Structure information
PDB ID 7sq4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Designed trefoil knot protein, variant 2
Assembly ID 1
Resolution 1.493Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7sq4-a1-m2-cA_7sq4-a1-m3-cA.pdb.gz
Full biological assembly
Download: 7sq4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7sq4/1/1:A/2:A 7sq4/1/1:A/3:A

[Back to Home]