7sqc/1/1:0C/1:0D

Sequences
>7sqc-a1-m1-c0C (length=58) [Search sequence]
ETFRKYLEQAGAIDVLVKVLVQLYEEPSKPKTALDYIKQCLGAEYEAVVAERDGLQKQ
>7sqc-a1-m1-c0D (length=63) [Search sequence]
SESQKETFRKYLEQAGAIDVLVKVLVQLYEEPSKPKTALDYIKQCLGAEYEAVVAERDGL
QKQ
Structure information
PDB ID 7sqc (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ciliary C1 central pair apparatus isolated from Chlamydomonas reinhardtii
Assembly ID 1
Resolution 3.8Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID 0C 0D
UniProt accession A8I439 A8I439
Species 3055 (Chlamydomonas reinhardtii) 3055 (Chlamydomonas reinhardtii)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7sqc-a1-m1-c0C_7sqc-a1-m1-c0D.pdb.gz
Full biological assembly
Download: 7sqc-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7som/1/1:U/1:T 7sqc/1/1:0A/1:0B 7sqc/1/1:0E/1:0F 7sqc/1/1:0G/1:0H
Other dimers with similar sequences but different poses
  • 7sqc/1/1:0L/1:0K 7sqc/1/1:0J/1:0I
  • [Back to Home]