7t2f/1/1:A/1:B

Sequences
>7t2f-a1-m1-cA (length=53) [Search sequence]
SGLVPRGSHMDLEELEEDLKQALREGRKVNILGIEVTTEEQARRLIEFLRRFI
>7t2f-a1-m1-cB (length=53) [Search sequence]
SGLVPRGSHMDLEELEEDLKQALREGRKVNILGIEVTTEEQARRLIEFLRRFI
Structure information
PDB ID 7t2f (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of the model HEEH mini protein homodimer HEEH_TK_rd5_0341
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession
Species 562 (Escherichia coli) 562 (Escherichia coli)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7t2f-a1-m1-cA_7t2f-a1-m1-cB.pdb.gz
Full biological assembly
Download: 7t2f-assembly1.cif.gz

[Back to Home]