7t5v/1/1:A/2:A

Sequences

>7t5v-a1-m1-cA (length=34) [Search sequence]

ERHLDDAFFRGYKNLEPEAKAQLRKMLDTFKKDF

>7t5v-a1-m2-cA (length=34) [Search sequence]

ERHLDDAFFRGYKNLEPEAKAQLRKMLDTFKKDF

Structure information

PDB ID	7t5v (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of E. coli CapH C-terminal domain I99M mutant
Assembly ID	1
Resolution	1.26Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	51
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	A0A1X1LKI5	A0A1X1LKI5
Species	562 (Escherichia coli)	562 (Escherichia coli)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7t5v-a1-m1-cA_7t5v-a1-m2-cA.pdb.gz

Full biological assembly Download: 7t5v-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

7t5w/1/1:A/1:D 7t5w/1/1:C/1:B