7tbp/2/3:A/6:A

Sequences
>7tbp-a2-m3-cA (length=103) [Search sequence]
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQ
PSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQ
>7tbp-a2-m6-cA (length=103) [Search sequence]
SVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQ
PSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQ
Structure information
PDB ID 7tbp (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of the HIV-1 myristoylated matrix protein
Assembly ID 2
Resolution 2.151Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 6
Chain ID A A
UniProt accession P12493 P12493
Species 11676 (Human immunodeficiency virus 1) 11676 (Human immunodeficiency virus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7tbp-a2-m3-cA_7tbp-a2-m6-cA.pdb.gz
Full biological assembly
Download: 7tbp-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1hiw/1/1:B/1:A 1hiw/1/1:B/1:C 1hiw/1/1:C/1:A 1hiw/2/1:Q/1:R 1hiw/2/1:S/1:Q 1hiw/2/1:S/1:R 7e1i/1/1:A/1:B 7e1i/1/1:A/1:C 7e1i/1/1:B/1:C 7e1i/2/1:D/1:F 7e1i/2/1:E/1:D 7e1i/2/1:E/1:F 7e1i/3/1:G/1:H 7e1i/3/1:G/1:I 7e1i/3/1:H/1:I 7e1i/4/1:J/1:K 7e1i/4/1:J/1:L 7e1i/4/1:K/1:L 7e1j/1/1:B/1:A 7e1j/1/1:B/1:C 7e1j/1/1:C/1:A 7e1j/2/1:E/1:D 7e1j/2/1:E/1:F 7jxr/1/1:A/1:D 7jxr/1/1:A/1:E 7jxr/1/1:D/1:E 7jxr/2/1:C/1:B 7jxr/2/1:F/1:B 7jxr/2/1:F/1:C 7jxs/1/1:A/1:C 7jxs/1/1:A/1:E 7jxs/1/1:E/1:C 7jxs/2/1:D/1:B 7jxs/2/1:D/1:F 7jxs/2/1:F/1:B 7ovq/1/1:A/1:B 7ovq/1/1:A/1:C 7ovq/1/1:B/1:C 7ovq/1/1:D/1:b 7ovq/1/1:D/1:P 7ovq/1/1:E/1:c 7ovq/1/1:E/1:Q 7ovq/1/1:F/1:d 7ovq/1/1:F/1:R 7ovq/1/1:M/1:Y 7ovq/1/1:O/1:m 7ovq/1/1:P/1:b 7ovq/1/1:Q/1:c 7ovq/1/1:R/1:d 7ovq/1/1:Z/1:l 7ovr/1/1:A/1:B 7ovr/1/1:A/1:C 7ovr/1/1:B/1:C 7ovr/1/1:D/1:b 7ovr/1/1:D/1:P 7ovr/1/1:E/1:c 7ovr/1/1:E/1:Q 7ovr/1/1:F/1:d 7ovr/1/1:F/1:R 7ovr/1/1:H/1:f 7ovr/1/1:I/1:U 7ovr/1/1:P/1:b 7ovr/1/1:Q/1:c 7ovr/1/1:R/1:d 7ovr/1/1:S/1:e 7tbp/1/1:B/2:B 7tbp/1/1:B/5:B 7tbp/1/2:B/5:B 7tbp/2/1:A/3:A 7tbp/2/1:A/6:A 7tbp/3/1:C/4:C 7tbp/3/1:C/7:C 7tbp/3/4:C/7:C
Other dimers with similar sequences but different poses
  • 7ovq/1/1:b/1:l 7ovq/1/1:A/1:D 7ovq/1/1:B/1:Q 7ovq/1/1:C/1:d 7ovq/1/1:c/1:f 7ovq/1/1:E/1:O 7ovq/1/1:F/1:I 7ovq/1/1:P/1:S 7ovq/1/1:R/1:Y
    		•

    [Back to Home]