7th0/1/1:A/2:A

Sequences
>7th0-a1-m1-cA (length=43) [Search sequence]
TIAERLRQEGEQSKALHIAKILESGVPLADIRFTGLSEEELAA
>7th0-a1-m2-cA (length=43) [Search sequence]
TIAERLRQEGEQSKALHIAKILESGVPLADIRFTGLSEEELAA
Structure information
PDB ID 7th0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Escherichia coli RpnA-S
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P31667 P31667
Species 511145 (Escherichia coli str. K-12 substr. MG1655) 511145 (Escherichia coli str. K-12 substr. MG1655)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7th0-a1-m1-cA_7th0-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7th0-assembly1.cif.gz

[Back to Home]