7th4/1/1:A/1:B

Sequences

>7th4-a1-m1-cA (length=291) [Search sequence]

MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERS
VAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPH
PEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQ
LFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQ
DDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRP

>7th4-a1-m1-cB (length=291) [Search sequence]

Structure information

PDB ID	7th4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	T. thermophilus methylenetetrahydrofolate reductase complex with 5-formyltetrahydrofolate
Assembly ID	1
Resolution	1.45Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	56
Sequence identity between the two chains	1.0
PubMed citation	36592927

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q5SLG6	Q5SLG6
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)
Function annotation	BioLiP:7th4A	BioLiP:7th4B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7th4-a1-m1-cA_7th4-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7th4-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3apt/1/1:B/1:A 8eac/1/1:B/1:A
Other dimers with similar sequences but different poses	3apy/4/1:G/1:H 3apy/1/1:A/1:B 3apy/2/1:C/1:D 3apy/3/1:E/1:F 7th5/1/1:B/1:A