7thi/1/1:B/1:A

Sequences

>7thi-a1-m1-cB (length=254) [Search sequence]

SKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLN
RSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNV
TPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGK
TILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAI
QAAIKKVEDQGKVK

>7thi-a1-m1-cA (length=255) [Search sequence]

Structure information

PDB ID	7thi (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Human Bisphosphoglycerate Mutase complexed with 2-phosphoglycolate
Assembly ID	1
Resolution	1.33Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P07738	P07738
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7thiB	BioLiP:7thiA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7thi-a1-m1-cB_7thi-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7thi-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1t8p/1/1:A/1:B 2a9j/1/1:A/1:B 2f90/1/1:B/1:A 2h4x/1/1:B/1:A 2h4z/1/1:B/1:A 2h52/1/1:B/1:A 2hhj/1/1:B/1:A 3nfy/1/1:A/1:B 7n3r/1/1:B/1:A 7n3s/1/1:B/1:A