7trv/2/1:C/1:D

Sequences
>7trv-a2-m1-cC (length=87) [Search sequence]
SNAHDLNDLYYYAEVVEHGGFSAAARVLGLPKSKLSRRLALLEERLGVRLIQRSTRRFAV
TDVGRTYYEHCKAIEEARAAQESIDLT
>7trv-a2-m1-cD (length=87) [Search sequence]
NAHDLNDLYYYAEVVEHGGFSAAARVLGLPKSKLSRRLALLEERLGVRLIQRSTRRFAVT
DVGRTYYEHCKAIEEARAAQESIDLTR
Structure information
PDB ID 7trv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the DNA-Binding Domain of the LysR family Transcriptional Regulator YfbA from Yersinia pestis
Assembly ID 2
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 0.989
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession A0A380PDL3 A0A380PDL3
Species 214092 (Yersinia pestis CO92) 214092 (Yersinia pestis CO92)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7trv-a2-m1-cC_7trv-a2-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7trv-assembly2.cif.gz
Similar dimers

[Back to Home]