7tt9/1/1:B/1:D

Sequences
>7tt9-a1-m1-cB (length=116) [Search sequence]
SLYERLGGEQKIARIAADIFDTHATNPTVASRFKDSDRERVIKMVTEFLSAGTGGPQDYT
GKSMPEAHRSMNINEAEYLAVIDDIMVALDKNEVGDQEKQELLMIAYSLKGEIIGA
>7tt9-a1-m1-cD (length=116) [Search sequence]
SLYERLGGEQKIARIAADIFDTHATNPTVASRFKDSDRERVIKMVTEFLSAGTGGPQDYT
GKSMPEAHRSMNINEAEYLAVIDDIMVALDKNEVGDQEKQELLMIAYSLKGEIIGA
Structure information
PDB ID 7tt9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Shewanella benthica Group 1 truncated hemoglobin C51S C71S Y34F variant
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
PubMed citation 39864624
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession A9DF82 A9DF82
Species 314608 (Shewanella benthica KT99) 314608 (Shewanella benthica KT99)
Function annotation BioLiP:7tt9B BioLiP:7tt9D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7tt9-a1-m1-cB_7tt9-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7tt9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 7tt9/1/1:A/1:D 7tt9/1/1:B/1:C
  • [Back to Home]