7tvk/2/1:D/1:F

Sequences
>7tvk-a2-m1-cD (length=118) [Search sequence]
PQLKIYGLREFLDPIKQELSDIINSCMTDALQYPPEKRNQRFFPLERSDFFYPPDRTERY
TIIELSMFEGRSVAAKKQLIRLLFERVQPLGISAQDLEITIFETPKHNWGFRGLPGDE
>7tvk-a2-m1-cF (length=118) [Search sequence]
PQLKIYGLREFLDPIKQELSDIINSCMTDALQYPPEKRNQRFFPLERSDFFYPPDRTERY
TIIELSMFEGRSVAAKKQLIRLLFERVQPLGISAQDLEITIFETPKHNWGFRGLPGDE
Structure information
PDB ID 7tvk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural, Kinetic, and Mechanistic Analysis of the Wild-Type and Inactivated Malonate Semialdehyde Decarboxylase: A Structural Basis for the Decarboxylase and Hydratase Activities
Assembly ID 2
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 77
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D F
UniProt accession
Species 47881 (Pseudomonas pavonaceae) 47881 (Pseudomonas pavonaceae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7tvk-a2-m1-cD_7tvk-a2-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7tvk-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7tvk/1/1:A/1:B 7tvk/1/1:A/1:C 7tvk/1/1:C/1:B 7tvk/2/1:D/1:E 7tvk/2/1:F/1:E

[Back to Home]