7twd/1/2:A/2:B

Sequences
>7twd-a1-m2-cA (length=44) [Search sequence]
SDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG
>7twd-a1-m2-cB (length=45) [Search sequence]
SDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIGG
Structure information
PDB ID 7twd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of AAGAB C-terminal dimerization domain
Assembly ID 1
Resolution 2.11Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 54
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q6PD74 Q6PD74
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7twd-a1-m2-cA_7twd-a1-m2-cB.pdb.gz
Full biological assembly
Download: 7twd-assembly1.cif.gz
Similar dimers

[Back to Home]