7u5y/1/1:F/1:B

Sequences

>7u5y-a1-m1-cF (length=221) [Search sequence]

HMQPFAIAPSILSADFARLGEDVDKVLAAGADIVHFDVMDNHYVPNLTIGPMVCSALRKY
GVSAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEASQHIDRSLQLIRDGGCKAGLVFNP
ATPLEVLKYVMDKVDMVLLMSVNPGFQKFIPGTLDKLREARALIDASGREIRLEIDGGVN
VKNIREIAAAGADTFVAGSAIFNAPDYAEVIRAMHAELAQA

>7u5y-a1-m1-cB (length=222) [Search sequence]

Structure information

PDB ID	7u5y (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of ribulose-phosphate 3-epimerase from Pseudomonas aeruginosa
Assembly ID	1
Resolution	2.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	87
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	B
UniProt accession	Q9I5T1	Q9I5T1
Species	208964 (Pseudomonas aeruginosa PAO1)	208964 (Pseudomonas aeruginosa PAO1)
Function annotation	BioLiP:7u5yF	BioLiP:7u5yB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7u5y-a1-m1-cF_7u5y-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7u5y-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7u5y/1/1:C/1:D 7u5y/1/1:E/1:A
Other dimers with similar sequences but different poses	7u5y/1/1:B/1:E 7u5y/1/1:C/1:B 7u5y/1/1:C/1:E 7u5y/1/1:D/1:A 7u5y/1/1:F/1:A 7u5y/1/1:F/1:D