7uhe/1/1:A/1:C

Sequences
>7uhe-a1-m1-cA (length=71) [Search sequence]
VKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLL
KSLWDYVKKNT
>7uhe-a1-m1-cC (length=74) [Search sequence]
ASTVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPE
GLLKSLWDYVKKNT
Structure information
PDB ID 7uhe (database links: RCSB PDB PDBe PDBj PDBsum)
Title Taf14 ET domain in complex with C-terminal tail of Taf2
Assembly ID 1
Resolution 1.66Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
PubMed citation 35676274
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P35189 P35189
Species 4930 (Saccharomyces) 4930 (Saccharomyces)
Function annotation BioLiP:7uheA BioLiP:7uheC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7uhe-a1-m1-cA_7uhe-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7uhe-assembly1.cif.gz

[Back to Home]