7uq2/1/1:D/1:F

Sequences

>7uq2-a1-m1-cD (length=86) [Search sequence]

MIEDIKGYKPHTEEKIGKVNAIKDAEVRLGLIFDALYDEFWEALDNCCEFAKNYAESLDQ LTIAKTKLKEASMWACRAVFQPEEKY

>7uq2-a1-m1-cF (length=87) [Search sequence]

IEDIKGYKPHTEEKIGKVNAIKDAEVRLGLIFDALYDEFWEALDNCEDCEFAKNYAESLD QLTIAKTKLKEASMWACRAVFQPEEKY

Structure information

PDB ID	7uq2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Vs.4 from T4 phage in complex with cGAMP
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	102
Sequence identity between the two chains	0.988
PubMed citation	36848932

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	F
UniProt accession	P13314	P13314
Species	10663 (Tequatrovirus)	10663 (Tequatrovirus)
Function annotation	BioLiP:7uq2D	BioLiP:7uq2F

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7uq2-a1-m1-cD_7uq2-a1-m1-cF.pdb.gz

Full biological assembly Download: 7uq2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7uq2/1/1:B/1:A 7uq2/1/1:E/1:C
Other dimers with similar sequences but different poses	7uq2/1/1:E/1:A 7uq2/1/1:C/1:F 7uq2/1/1:D/1:B