7uq2/1/1:E/1:A

Sequences
>7uq2-a1-m1-cE (length=86) [Search sequence]
MIEDIKGYKPHTEEKIGKVNAIKDAEVRLGLIFDALYDEFWEALDNCCEFAKNYAESLDQ
LTIAKTKLKEASMWACRAVFQPEEKY
>7uq2-a1-m1-cA (length=89) [Search sequence]
SMIEDIKGYKPHTEEKIGKVNAIKDAEVRLGLIFDALYDEFWEALDNCEDCEFAKNYAES
LDQLTIAKTKLKEASMWACRAVFQPEEKY
Structure information
PDB ID 7uq2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Vs.4 from T4 phage in complex with cGAMP
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 57
Sequence identity between the two chains 1.0
PubMed citation 36848932
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E A
UniProt accession P13314 P13314
Species 10663 (Tequatrovirus) 10663 (Tequatrovirus)
Function annotation BioLiP:7uq2E BioLiP:7uq2A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7uq2-a1-m1-cE_7uq2-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7uq2-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7uq2/1/1:C/1:F 7uq2/1/1:D/1:B
Other dimers with similar sequences but different poses
  • 7uq2/1/1:D/1:F 7uq2/1/1:B/1:A 7uq2/1/1:E/1:C
  • [Back to Home]