7v6w/2/1:I/1:J

Sequences

>7v6w-a2-m1-cI (length=56) [Search sequence]

MIITSPTEARKDFYQLLKNVNNNHEPIYISGNNAENNAVIIGLEDWKSIQETIYLE

>7v6w-a2-m1-cJ (length=85) [Search sequence]

MIITSPTEARKDFYQLLKNVNNNHEPIYISGNNAENNAVIIGLEDWKSIQETIYLESTGT MDKVREREKDNSGTTNIDDIDWDNL

Structure information

PDB ID	7v6w (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of heterohexameric Sa2YoeB-Sa2YefM complex bound to 26bp-DNA
Assembly ID	2
Resolution	2.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	83
Sequence identity between the two chains	1.0
PubMed citation	34861238

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	I	J
UniProt accession	Q2FVF7	Q2FVF7
Species	93061 (Staphylococcus aureus subsp. aureus NCTC 8325)	93061 (Staphylococcus aureus subsp. aureus NCTC 8325)
Function annotation	BioLiP:7v6wI	BioLiP:7v6wJ

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7v6w-a2-m1-cI_7v6w-a2-m1-cJ.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7v6w-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7v5y/1/1:A/1:B 7v5y/1/1:C/1:D 7v5z/1/1:A/1:B 7v6w/1/1:A/1:B 7v6w/1/1:C/1:D 7v6w/2/1:K/1:L
Other dimers with similar sequences but different poses	7v6w/2/1:I/1:K 7v5y/1/1:A/1:C 7v6w/1/1:C/1:A