7v6w/2/1:I/1:K

Sequences
>7v6w-a2-m1-cI (length=56) [Search sequence]
MIITSPTEARKDFYQLLKNVNNNHEPIYISGNNAENNAVIIGLEDWKSIQETIYLE
>7v6w-a2-m1-cK (length=58) [Search sequence]
MIITSPTEARKDFYQLLKNVNNNHEPIYISGNNAENNAVIIGLEDWKSIQETIYLEST
Structure information
PDB ID 7v6w (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of heterohexameric Sa2YoeB-Sa2YefM complex bound to 26bp-DNA
Assembly ID 2
Resolution 2.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
PubMed citation 34861238
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I K
UniProt accession Q2FVF7 Q2FVF7
Species 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)
Function annotation BioLiP:7v6wI BioLiP:7v6wK
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7v6w-a2-m1-cI_7v6w-a2-m1-cK.pdb.gz
Full biological assembly
Download: 7v6w-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7v5y/1/1:A/1:C 7v6w/1/1:C/1:A
Other dimers with similar sequences but different poses
  • 7v6w/2/1:I/1:J 7v5y/1/1:A/1:B 7v5y/1/1:C/1:D 7v5z/1/1:A/1:B 7v6w/1/1:A/1:B 7v6w/1/1:C/1:D 7v6w/2/1:K/1:L
  • [Back to Home]