7viv/1/3:A/3:B

Sequences

>7viv-a1-m3-cA (length=72) [Search sequence]

METQKLISMVKEALEKYQYPLTAKNIKVVIQKEHNVVLPTGSINSILYSNSELFEKIDKT NTIYPPLWIRKN

>7viv-a1-m3-cB (length=72) [Search sequence]

METQKLISMVKEALEKYQYPLTAKNIKVVIQKEHNVVLPTGSINSILYSNSELFEKIDKT NTIYPPLWIRKN

Structure information

PDB ID	7viv (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the I73R from African Swine Fever Virus
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	29
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	A	B
UniProt accession	A0A2X0RU36	A0A2X0RU36
Species	10497 (African swine fever virus)	10497 (African swine fever virus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7viv-a1-m3-cA_7viv-a1-m3-cB.pdb.gz

Full biological assembly Download: 7viv-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7viv/1/1:A/1:B 7viv/1/2:A/2:B
Other dimers with similar sequences but different poses	7viv/1/1:A/3:B 7viv/1/1:B/2:A 7viv/1/2:B/3:A