7vox/2/1:B/1:H

Sequences

>7vox-a2-m1-cB (length=83) [Search sequence]

HAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDC FVKVARSPDKPGKGSYWTLHPDS

>7vox-a2-m1-cH (length=85) [Search sequence]

HAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDC FVKVARSPDKPGKGSYWTLHPDSGN

Structure information

PDB ID	7vox (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of human forkhead box protein A in complex with DNA 2
Assembly ID	2
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	22
Sequence identity between the two chains	1.0
PubMed citation	35920317

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	H
UniProt accession	P55317	P55317
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7voxB	BioLiP:7voxH

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7vox-a2-m1-cB_7vox-a2-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7vox-assembly2.cif.gz

Similar dimers