7vp2/1/1:B/1:A

Sequences

>7vp2-a1-m1-cB (length=58) [Search sequence]

KDRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKTAIDKL

>7vp2-a1-m1-cA (length=83) [Search sequence]

LKGYSVGGGEIVEVQGGHIIRATGRKDRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRL GYDRPSKAVDWLIKKAKTAIDKL

Structure information

PDB ID	7vp2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of a transcription factor and DNA complex
Assembly ID	1
Resolution	1.92Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	133
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	O82277	O82277
Species	3702 (Arabidopsis thaliana)	3702 (Arabidopsis thaliana)
Function annotation	BioLiP:7vp2B	BioLiP:7vp2A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7vp2-a1-m1-cB_7vp2-a1-m1-cA.pdb.gz

Full biological assembly Download: 7vp2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7vp1/1/1:B/1:A 7vp4/1/1:B/1:A 7vp4/2/1:F/1:E 7vp4/3/1:I/1:J 7vp5/1/1:A/1:B 7vp5/2/1:E/1:F 7vp7/1/1:B/1:A