7vp3/4/1:P/1:N

Sequences
>7vp3-a4-m1-cP (length=61) [Search sequence]
STKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATGTG
T
>7vp3-a4-m1-cN (length=62) [Search sequence]
TKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATGTGT
IP
Structure information
PDB ID 7vp3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a transcription factor and DNA complex
Assembly ID 4
Resolution 3.003Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 137
Sequence identity between the two chains 0.984
PubMed citation 36546761
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID P N
UniProt accession Q9C9L2 Q9C9L2
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:7vp3P BioLiP:7vp3N
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7vp3-a4-m1-cP_7vp3-a4-m1-cN.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7vp3-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7vp3/1/1:D/1:J 7vp3/2/1:G/1:C 7vp3/3/1:I/1:L 7vp6/1/1:J/1:D

[Back to Home]